Name | Apelin 12, 1-10, K3 |
Sequence | RPKLSHKGPM |
3-letter-code | Arg - Pro - Lys - Leu - Ser - His - Lys - Gly - Pro - Met |
Notes | Arg 3 is replaced by Lysine (Lys). Missing the two C-terminal amino acids Pro Phe of Apelin 12. |
Molecular weight | 1150.41 |
| | | | | | | |
Order Apelin 12, 1-10, K3 peptide
Amount | Cat.No. | | | | | Unit price | |
---|
1 mg | SP-5143-1 | | | 75 EUR | BUY |
5 mg | SP-5143-5 | | | 290 EUR | BUY |
|
For larger amounts please inquire. | |
The catalog entry for Apelin 12, human may contain more information and related peptides.
Related peptides
Name | | Sequence | | | | | |
---|
Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF |
Apelin 17, human | KFRRQRPRLSHKGPMPF |
Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |