| Name | Apelin 13, Pyr1, K4, D6 |
| Sequence | (Pyr)RPKLDHKGPMPF |
| 3-letter-code | Pyr - Arg - Pro - Lys - Leu - Asp - His - Lys - Gly - Pro - Met - Pro - Phe |
| Notes | Arg 4 replaced by Lys, Ser 6 replaced by Asp. |
| Molecular weight | 1533.82 |
| | | | | | | |
Order Apelin 13, Pyr1, K4, D6 peptide
| Amount | Cat.No. | | | | | Unit price | |
|---|
| 1 mg | SP-5174-1 | | | 75 EUR | BUY |
| 5 mg | SP-5174-5 | | | 290 EUR | BUY |
|
| For larger amounts please inquire. | |
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
| Name | | Sequence | | | | | |
|---|
| Apelin 12, human | RPRLSHKGPMPF |
| Apelin 17, human | KFRRQRPRLSHKGPMPF |
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |