| Name | Apelin 13, Pyr1, N11 |
| Sequence | (Pyr)RPRLSHKGPNPF |
| 3-letter-code | Pyr - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Asn - Pro - Phe |
| Notes | Met 11 is replaced by Asparagine (Asn). |
| Molecular weight | 1516.73 |
| | | | | | | |
Order Apelin 13, Pyr1, N11 peptide
| Amount | Cat.No. | | | | | Unit price | |
|---|
| 1 mg | SP-5155-1 | | | 75 EUR | BUY |
| 5 mg | SP-5155-5 | | | 290 EUR | BUY |
|
| For larger amounts please inquire. | |
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
| Name | | Sequence | | | | | |
|---|
| Apelin 12, human | RPRLSHKGPMPF |
| Apelin 17, human | KFRRQRPRLSHKGPMPF |
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |