Name | Apelin 13, Pyr1, K7 |
Sequence | (Pyr)RPRLSKKGPMPF |
3-letter-code | Pyr - Arg - Pro - Arg - Leu - Ser - Lys - Lys - Gly - Pro - Met - Pro - Phe |
Notes | His 7 is replaced by Lysine (Lys). |
Molecular weight | 1524.85 |
| | | | | | | |
Order Apelin 13, Pyr1, K7 peptide
Amount | Cat.No. | | | | | Unit price | |
---|
1 mg | SP-5148-1 | | | 75 EUR | BUY |
5 mg | SP-5148-5 | | | 290 EUR | BUY |
|
For larger amounts please inquire. | |
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
Name | | Sequence | | | | | |
---|
Apelin 12, human | RPRLSHKGPMPF |
Apelin 17, human | KFRRQRPRLSHKGPMPF |
Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |