| Name | Apelin 13, Pyr1, K7 | 
| Sequence | (Pyr)RPRLSKKGPMPF | 
| 3-letter-code | Pyr - Arg - Pro - Arg - Leu - Ser - Lys - Lys - Gly - Pro - Met - Pro - Phe | 
| Notes | His 7 is replaced by Lysine (Lys). | 
| Molecular weight | 1524.85 | 
 |  |  |  |  |  |  |  | 
Order Apelin 13, Pyr1, K7 peptide
 | Amount | Cat.No. |  |  |  |  | Unit price |  | 
|---|
| 1 mg | SP-5148-1 |  |  | 75 EUR | BUY | 
| 5 mg | SP-5148-5 |  |  | 290 EUR | BUY | 
 | 
| For larger amounts please inquire. |  | 
 The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
| Name |  | Sequence |   |  |  |  |  | 
|---|
| Apelin 12, human | RPRLSHKGPMPF | 
| Apelin 17, human | KFRRQRPRLSHKGPMPF | 
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |