| Name | Apelin 13, Pyr1, S9 |
| Sequence | (Pyr)RPRLSHKSPMPF |
| 3-letter-code | Pyr - Arg - Pro - Arg - Leu - Ser - His - Lys - Ser - Pro - Met - Pro - Phe |
| Notes | Gly 9 is replaced by Serine (Ser). |
| Molecular weight | 1563.85 |
| | | | | | | |
Order Apelin 13, Pyr1, S9 peptide
| Amount | Cat.No. | | | | | Unit price | |
|---|
| 1 mg | SP-5158-1 | | | 75 EUR | BUY |
| 5 mg | SP-5158-5 | | | 290 EUR | BUY |
|
| For larger amounts please inquire. | |
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
| Name | | Sequence | | | | | |
|---|
| Apelin 12, human | RPRLSHKGPMPF |
| Apelin 17, human | KFRRQRPRLSHKGPMPF |
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |