Name | Apelin 13, Pyr1, I5, D6 |
Sequence | (Pyr)RPRIDHKGPMPF |
3-letter-code | Pyr - Arg - Pro - Arg - Ile - Asp - His - Lys - Gly - Pro - Met - Pro - Phe |
Notes | Leu 5replaced Ile, Ser 6 replaced by Asp. |
Molecular weight | 1561.83 |
| | | | | | | |
Order Apelin 13, Pyr1, I5, D6 peptide
Amount | Cat.No. | | | | | Unit price | |
---|
1 mg | SP-5180-1 | | | 75 EUR | BUY |
5 mg | SP-5180-5 | | | 290 EUR | BUY |
|
For larger amounts please inquire. | |
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
Name | | Sequence | | | | | |
---|
Apelin 12, human | RPRLSHKGPMPF |
Apelin 17, human | KFRRQRPRLSHKGPMPF |
Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |