Name | Apelin 13, Pyr1, dL5, D6, T12 |
Sequence | (Pyr)RPR(dL)DHKGPMTF |
3-letter-code | Pyr - Arg - Pro - Arg - d - Leu - Asp - His - Lys - Gly - Pro - Met - Thr - Phe |
Notes | d-Leu 5, Ser 6replaced by Asp, Pro 12 by Thr. |
Molecular weight | 1565.82 |
| | | | | | | |
Order Apelin 13, Pyr1, dL5, D6, T12 peptide
Amount | Cat.No. | | | | | Unit price | |
---|
1 mg | SP-5190-1 | | | 75 EUR | BUY |
5 mg | SP-5190-5 | | | 290 EUR | BUY |
|
For larger amounts please inquire. | |
The catalog entry for Apelin 13, Pyr1, human may contain more information and related peptides.
Related peptides
Name | | Sequence | | | | | |
---|
Apelin 12, human | RPRLSHKGPMPF |
Apelin 17, human | KFRRQRPRLSHKGPMPF |
Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |