| Name | Apelin 13, Pyr1, A12 |
| Sequence | (Pyr)RPRLSHKGPMAF-NH2 |
| 3-letter-code | Pyr - Arg - Pro - Arg - Leu - Ser - His - Lys - Gly - Pro - Met - Ala - Phe -NH2 |
| C-terminus | Amide |
| Notes | Pro 12 is replaced by an Alanine (Ala). |
| Molecular weight | 1506.80 |
| | | | | | | |
Order Apelin 13, Pyr1, A12 peptide
| Amount | Cat.No. | | | | | Unit price | |
|---|
| 1 mg | SP-5139-1 | | | 95 EUR | BUY |
| 5 mg | SP-5139-5 | | | 370 EUR | BUY |
|
| For larger amounts please inquire. | |
The catalog entry for Apelin 13, Pyr1 - Alanine scan may contain more information and related peptides.
Related peptides
| Name | | Sequence | | | | | |
|---|
| Apelin 12, human | RPRLSHKGPMPF |
| Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF |
| Apelin 17, human | KFRRQRPRLSHKGPMPF |
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |