| Name | Apelin 13, Pyr1, A04 |
| Sequence | (Pyr)RPALSHKGPMPF-NH2 |
| 3-letter-code | Pyr - Arg - Pro - Ala - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe -NH2 |
| C-terminus | Amide |
| Notes | Arg 4 is replaced by an Alanine (Ala). |
| Molecular weight | 1447.73 |
| | | | | | | |
Order Apelin 13, Pyr1, A04 peptide
| Amount | Cat.No. | | | | | Unit price | |
|---|
| 1 mg | SP-5131-1 | | | 95 EUR | BUY |
| 5 mg | SP-5131-5 | | | 370 EUR | BUY |
|
| For larger amounts please inquire. | |
The catalog entry for Apelin 13, Pyr1 - Alanine scan may contain more information and related peptides.
Related peptides
| Name | | Sequence | | | | | |
|---|
| Apelin 12, human | RPRLSHKGPMPF |
| Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF |
| Apelin 17, human | KFRRQRPRLSHKGPMPF |
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |