Name | Apelin 13, Pyr1, A04 |
Sequence | (Pyr)RPALSHKGPMPF-NH2 |
3-letter-code | Pyr - Arg - Pro - Ala - Leu - Ser - His - Lys - Gly - Pro - Met - Pro - Phe -NH2 |
C-terminus | Amide |
Notes | Arg 4 is replaced by an Alanine (Ala). |
Molecular weight | 1447.73 |
| | | | | | | |
Order Apelin 13, Pyr1, A04 peptide
Amount | Cat.No. | | | | | Unit price | |
---|
1 mg | SP-5131-1 | | | 95 EUR | BUY |
5 mg | SP-5131-5 | | | 370 EUR | BUY |
|
For larger amounts please inquire. | |
The catalog entry for Apelin 13, Pyr1 - Alanine scan may contain more information and related peptides.
Related peptides
Name | | Sequence | | | | | |
---|
Apelin 12, human | RPRLSHKGPMPF |
Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF |
Apelin 17, human | KFRRQRPRLSHKGPMPF |
Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |