| Name | Apelin 12, 1-10, K6 |
| Sequence | RPRLSKKGPM |
| 3-letter-code | Arg - Pro - Arg - Leu - Ser - Lys - Lys - Gly - Pro - Met |
| Notes | His 6 is replaced by Lysine (Lys). Missing the two C-terminal amino acids Pro Phe of Apelin 12. |
| Molecular weight | 1169.46 |
| | | | | | | |
Order Apelin 12, 1-10, K6 peptide
| Amount | Cat.No. | | | | | Unit price | |
|---|
| 1 mg | SP-5145-1 | | | 75 EUR | BUY |
| 5 mg | SP-5145-5 | | | 290 EUR | BUY |
|
| For larger amounts please inquire. | |
The catalog entry for Apelin 12, human may contain more information and related peptides.
Related peptides
| Name | | Sequence | | | | | |
|---|
| Apelin 13, Pyr1, human | (Pyr)RPRLSHKGPMPF |
| Apelin 17, human | KFRRQRPRLSHKGPMPF |
| Apelin 36, human | LVQPRGSRNGPGPWQGGRRKFRRQRPRLSHKGPMPF |